PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00001749-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MYB_related
Protein Properties Length: 462aa    MW: 51221.8 Da    PI: 5.9124
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00001749-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.45.2e-1658102147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         r +WT+eE+ ++++a k++G g W+ I +++g ++t+ q++s+ qk+
  WALNUT_00001749-RA  58 REKWTEEEHRKFLEALKLFGRG-WRQIEAHVG-TKTAVQIRSHAQKF 102
                         789*******************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.11353107IPR017930Myb domain
SuperFamilySSF466891.05E-1553106IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-1656105IPR006447Myb domain, plants
SMARTSM007172.0E-1257105IPR001005SANT/Myb domain
PfamPF002498.8E-1458101IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-95898IPR009057Homeodomain-like
CDDcd001671.62E-1060103No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 462 aa     Download sequence    Send to blast
MTLQQDEGKT SDASVTAGNY RSDGSAQTET VVQKEEICSF GDYATPKVRK PYTIVKQREK  60
WTEEEHRKFL EALKLFGRGW RQIEAHVGTK TAVQIRSHAQ KFFSKVVRAS SGSTENTIEP  120
VEIPPPRPKK KPSHPYPRKS VDSLNGISVT NQLERSPSPN LLVGEKDTKS PTSVLSASGS  180
DSLGSAVSEQ LNACSSPNSC TTDMHSSTTS PVEKENVHMT SNSTVQEEKD PFSSTPQCFL  240
SMKLELASKD TLGNMGDEAT GAPITSIKLF GRTVVVTDFQ RPCSSGSENS ESLPSDESPE  300
NIDTERLVNY NCESLPCRAP DRRMEHRKEN TDSAEANHYA SLPWWTRYQG LPFYCSPSYN  360
QTSVQVPTGY CVEEETNERD IGKEKSCTGS NSAIINEVEN GEKNLVGVDS EAQETLVERR  420
MISPCNHKKG FVPYKRCRAE RDANSSMMVM EEREGQRARV CS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00146DAPTransfer from AT1G18330Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007037069.11e-142Homeodomain-like superfamily protein, putative isoform 1
SwissprotB3H5A81e-55RVE7_ARATH; Protein REVEILLE 7
TrEMBLA0A061FVK61e-142A0A061FVK6_THECC; Homeodomain-like superfamily protein, putative isoform 1
STRINGPOPTR_0015s05430.11e-130(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73133244
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18330.15e-45MYB_related family protein